PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G40120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 254aa    MW: 28300.3 Da    PI: 8.8387
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G40120.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.76.5e-144289148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed +lv  v++lG ++W+  a+  g+ R++k+c++rw +yl
  LPERR01G40120.1 42 KGPWTEQEDVQLVWFVRLLGERRWDFLAKVSGLQRSGKSCRLRWVNYL 89
                     79********************************************97 PP

2Myb_DNA-binding60.63.2e-1995140148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr+++eE+   v++++++G++ W++Ia+ m+ gRt++++k++w+++l
  LPERR01G40120.1  95 RGRMSPEEERMVVQLHAKHGNR-WSRIAKSMP-GRTDNEIKNYWRTHL 140
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.4173789IPR017930Myb domain
SuperFamilySSF466892.46E-2839136IPR009057Homeodomain-like
SMARTSM007177.3E-114191IPR001005SANT/Myb domain
PfamPF002491.6E-124289IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-174396IPR009057Homeodomain-like
CDDcd001679.98E-94489No hitNo description
PROSITE profilePS5129427.74890144IPR017930Myb domain
SMARTSM007171.5E-1894142IPR001005SANT/Myb domain
PfamPF002492.7E-1795140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2597143IPR009057Homeodomain-like
CDDcd001676.10E-1497140No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MVVGGKKVQA SRQPGRSSSS SSSAVVVQQA EVAAAGKGGM RKGPWTEQED VQLVWFVRLL  60
GERRWDFLAK VSGLQRSGKS CRLRWVNYLH PGLKRGRMSP EEERMVVQLH AKHGNRWSRI  120
AKSMPGRTDN EIKNYWRTHL RKQAAQKQQL NLQAASTPSS SSISDDDHNS SSSSSSSNGS  180
SSNNNNNDDS MQQQQQLSSF HLPLWNDDNI DCWSSTQLVA PASPLWDIDD AFCSDYSLPL  240
PLWGSAHDDA DYIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-26421444105MYB PROTO-ONCOGENE PROTEIN
1h88_C8e-264214458159MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-264214458159MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-26421444105C-Myb DNA-Binding Domain
1msf_C3e-26421444105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3985811e-134AY398581.1 Oryza sativa (indica cultivar-group) Myb factor protein (Myb) mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621159.15e-84PREDICTED: transcription factor MYB59
TrEMBLA0A0D9VAY20.0A0A0D9VAY2_9ORYZ; Uncharacterized protein
STRINGOB01G54920.18e-99(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.35e-57myb domain protein 59